PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN48423.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 2417aa    MW: 265857 Da    PI: 5.2521
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN48423.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.97e-3621212175660
      zf-Dof    6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60  
                   +cprC s+ntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rkn++
  KHN48423.1 2121 PNCPRCGSSNTKFCYYNNYSLTQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRR 2175
                  58***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2421072166IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.67721212175IPR003851Zinc finger, Dof-type
PfamPF027013.4E-3021222175IPR003851Zinc finger, Dof-type
PROSITE patternPS01361021232159IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 2417 aa     Download sequence    Send to blast
MGRPEPCVLF AQNFVHTHLD EYVDEVMFSE PIVITACEFL EQTASSAAQA VTLVGATSPP  60
SFAIEVFVHC EGETRFRRLC QPFLYSHSSS NVLEVEAVVT SHLVVRGSYR SLSLVIYGNT  120
AEDLGQFNID IDDNALTDLV DSTEGKLEDL PPALRSTNFT IDDSRSSLRV LSIPVPATDI  180
SVEVNLFLQL MLKILEFSEL GDAGHKIVDP VVSAITSYIS SDICESIGGR YQMQKRSENL  240
EELHSVVNEG RKELLEVYKV LHKKIRSGSS ECSPDANYLE MDAEMLDSKT LVDMFNQYFH  300
FQRHSSCIGD HCLSQSEHAL LILSMAYLLC SGRESGFQFV SSGGMEQLAV FFSKDWQNST  360
TIMLLLLGVV ERATRYSVGC EAFLGWWPRE DENIPSSISE GYSHLLKLIL SKPRHDVASL  420
ATYLLHRLRF YEIASRYESA VLSVLGNIGT VGRVTDVTLN MLSSAEILLR KLLKLINSRG  480
PIEDPSPIAC ASRSLITGQT DGLLSYKTTS SLISSSSCCF SDCDIDSHLL GLLKERGFLS  540
LSTALLSSSI LRVESGHVME IFMDVTSSIE AVILSFLFCR SGLILLLQDP ELSSTLIRAL  600
RGGHRGNKED CIPLRYASIL ISKGFFCSPP EIGMIIEIHL KMVNAVDSLL SLNPQSEEFL  660
WVVWELSMLS RSDCGRQALL ALGNFPEAVS FLIEALSSIK ESESVGKSSG SSAVNLTIFH  720
SAAEIIEAIV TDSTASSLGS WIGHALELHR ALNFSSPGSN RKDAPSRLLE WIDAGVVFHK  780
QGGIGLLRYA AVLASGGDAQ LTSVLVSDLT DVETVVGESS SCSDINVMEN LGKFISEKSF  840
DGVTLRDSSL AQLTTALRIL SFISENPTVA ATLYDEGAVI VIYAILVNCR FMLERSSNNY  900
DYLVDEGTEC NATSDLLLER NRELNIVDLL VPSLVLLITL LKKLQEAKEQ HRNTKLMNAL  960
LRLHREISPK LAACADDFSS PYPDYAIGYG AVCHLVASAL AFWPVHGWSP GLFHTLLASV  1020
QSTSLLTLGP KETCSLLYLL IDLLPEEDIW LWTSGMPLLT ARRMLAVGNI LGPQKEKHIN  1080
WYLESGHQEK LVGQLAPHLD KIAEIIQHYA VSALVVIQDL LCVFVIRIAC QNAKYASMLM  1140
EPVLSSVIHH VSESSCPSDT DAYKVLRLLD FLASLLEHPL GKVLPVGKEL LACLTAFKEL  1200
ASCGEGQMAF GATHFGIHSH ALELEPRKDD RNVNYVSSVA EWIKCPPLLS CWMKLLRSID  1260
TKEGLSTYAI EAAYALSVGS LQFCMNGDSL NSDRVVALKY LFGISDDMTR SVVFPEENIN  1320
YIQEFSALLS SKASMDDCLV TSHSQIPLYQ VSESVKSLSL VLERPVDSMK LEDVVLHQNE  1380
VLVFSKTHQL LENSVEKIDD HLYVGGLGDK FLWECPETLP DRLTQTNLAA KRKLPSMDGP  1440
VRRARGESFQ ADMSSQNVFS RGVAQSAVSS GPTRRDAFRQ RKPNTSRPPS MHVDDYVARE  1500
RNVEGVTNVI SVPRAGSTGG RPPSIHVDEF MARQRERQNP SATVVGEAVG HLKNASPVKP  1560
TDTEKLNKSK QLKTDLDDDL QGIDIVFDGE GSDPDDKLPF PQLDDNLQQP APAIVEQSSP  1620
HSIVEETESD VVDSSQFSQM GTPLGSNIDE NAQSEFSSKM SGSRPDMSLT RESSVSSDRK  1680
SAEQLDDSKN VQARPSGRYD SVASNTSFPM SLYNNPSASM QSPADSRMVS QNYLLKTSPQ  1740
HGGIASGSQG LYDQRFMPNQ PPLPPMPPPP TVLPVISHAS DSVPGHSSPY VNSPAGTQRP  1800
VAFQVQLDYS SPFNNGSTAA SSVPVPDSKY SRTSVSSPGG PNRIAPPLPP TPPPFASSQY  1860
NLPIVKASAS QPSMYNQTSI GATELSQASI ASSGARLSSY PNPSMMSVGF SRPASMPLTM  1920
FGNSLNQQQT ENQPSMLQSV SVPPSSFQSM HSVSQLQPPQ LPRPPQPPQL LRPTVQALQQ  1980
LEQGMGLQSN VQVHQLQMLQ QSQVPSMQTN YQTQQQQFSH EQQQQVEYTQ QPGNCQSQQQ  2040
QDAAMSLHEY FKSPEAIQSL LSDRDKLCQL LEQHPKLMQM LQNIDGQYYG WRVASDEKLE  2100
WGCVCFVVME SGWKPEVEIS PNCPRCGSSN TKFCYYNNYS LTQPRYFCKG CRRYWTKGGS  2160
LRNVPVGGGC RKNRRGNKTL LRQSIDGFTF KNSLPPCGNV TDHNNNPIGH SYDPRIRTSS  2220
ASSSSSVVSD GPHIDLALVY ANFLNQKPNS EARVESTNPD QVQTVFYPSL ENNSRLSNTV  2280
VVGPNTLPEE LGLTGCLNLP EQQPQTHSSE ANNNHNQMCY GEFNTMQTLH QKDGIDQQCS  2340
NHGGGAMNFE LPPLPGEEEV SHDHHMMWSN SEMMINHHHA FQVTQPPLLG PDVHDADLLI  2400
GNWSSFDLPR DASFSRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006588873.10.0PREDICTED: uncharacterized protein LOC100787719
TrEMBLA0A0B2SU240.0A0A0B2SU24_GLYSO; Dof zinc finger protein DOF3.5
STRINGGLYMA10G10154.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.19e-41Dof family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]